Sermorelin research vial
Sequence length
29 AA
Molecular weight
3357.9 g/mol
Current batch
SERMO202604
GH axis · Endocrine / GHRH receptor signaling and somatotroph research

Sermorelin

Synthetic GHRH(1-29) analog of human growth hormone-releasing hormone

Out of stock · next batch expected soon
Restocking soon

Get a one-time email when this batch ships.

One email. No marketing. Unsubscribe instantly.

Specifications

Molecular weight3357.9 g/mol
Sequence length29 amino acids
Amino acid sequenceTyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
AppearanceWhite lyophilized powder
SolubilityBacteriostatic water; sterile water
Storage (lyophilized)-20°C, protected from light
Storage (reconstituted)2–8°C, use within 28 days
Half-life~11–12 minutes (plasma, human studies)
Current batch purity99.89% (HPLC) · SERMO202604

Sermorelin is a synthetic 29-amino-acid peptide corresponding to the N-terminal fragment GHRH(1-29)-NH2 — the shortest sequence of human growth hormone-releasing hormone that retains full biological activity at the pituitary GHRH receptor. The peptide binds GHRH receptors on anterior pituitary somatotrophs and stimulates pulsatile endogenous growth hormone release, preserving the negative-feedback architecture of the somatotropic axis. Sermorelin has been studied extensively since the 1980s in human endocrine research, including as a provocative diagnostic agent for growth hormone deficiency and in pediatric growth hormone-deficiency cohorts. NovaWell supplies Sermorelin as a lyophilized acetate salt, third-party tested for purity and endotoxin conformance, for laboratory research use only.

Research Studies

The following studies are summarized for educational purposes only. Inclusion does not imply any human use; all referenced research was conducted under regulated clinical-research conditions or in animal/in vitro models.

Research study

Sermorelin: a review of its use in the diagnosis and treatment of children with idiopathic growth hormone deficiency

Prakash A, Goa KL. BioDrugs. 1999 Aug;12(2):139–157. View source ↗

Scientific findings

This review consolidates the pharmacology and clinical research literature on Sermorelin — characterized as a 29-amino-acid analog of human GHRH and the shortest synthetic peptide with full biological activity of GHRH. The authors describe that intravenous and subcutaneous Sermorelin specifically stimulate growth hormone secretion from the anterior pituitary somatotrophs via the GHRH receptor, with peak GH responses typically observed 15–60 minutes after administration. Single-dose intravenous Sermorelin at 1 μg/kg bodyweight is reviewed as a relatively specific provocative test for the diagnosis of GH deficiency, with fewer false positives in children without GH deficiency compared with several conventional provocative tests. The review summarizes clinical research in which once-daily subcutaneous Sermorelin at 30 μg/kg bodyweight at bedtime produced sustained increases in height velocity over 12 months in prepubertal children with idiopathic GH deficiency, with data from a smaller subset suggesting maintenance of effect through 36 months. The authors note that increases in height velocity from baseline with Sermorelin were generally smaller than those reported with once-daily subcutaneous somatropin, and that transient facial flushing and injection-site pain were the most commonly reported adverse events.

Plain English

This is a comprehensive review article that pulls together what was known about Sermorelin by 1999. The authors explain that Sermorelin is essentially the "business end" of the body's natural GHRH hormone — the first 29 amino acids, which is all you need to flip the pituitary's growth-hormone switch. They review studies showing that a single small dose can be used as a diagnostic probe to see whether a child's pituitary is capable of releasing growth hormone. They also summarize trials in which children with growth hormone deficiency received daily bedtime injections and grew faster over the year that followed. Side effects were mostly mild — flushing of the face and soreness where the needle went in.

Research study

Once daily subcutaneous growth hormone-releasing hormone therapy accelerates growth in growth hormone-deficient children during the first year of therapy. Geref International Study Group

Thorner M, Rochiccioli P, Colle M, Lanes R, Grunt J, Galazka A, Landy H, Eengrand P, Shah S. J Clin Endocrinol Metab. 1996 Mar;81(3):1189–1196. View source ↗

Scientific findings

This multicenter, open-label clinical study enrolled 110 previously untreated prepubertal children with documented GH deficiency, of whom 86 were eligible for efficacy analysis. Participants received subcutaneous GHRH(1-29) (Sermorelin) at 30 μg/kg per day administered once daily at bedtime for up to 12 months, with linear growth, bone-age progression, and clinical chemistry monitored at 3–6 month intervals. Mean height velocity rose from 4.1 ± 0.9 cm/year at baseline to 8.0 ± 1.5 cm/year at 6 months and 7.2 ± 1.3 cm/year at 12 months, and 74% of children met the investigators' definition of a "good response" at the 6-month mark. The ratio of change in bone age to change in height age was not significantly different from unity (1.04 ± 0.58; P = 0.63), indicating proportionate skeletal maturation rather than disproportionate bone-age advancement. No adverse changes in fasting glucose, IGF-1 generation, or general biochemical and hormonal panels were observed, and the once-daily bedtime regimen was generally well tolerated.

Plain English

Researchers gave a single nightly Sermorelin injection to over 100 children whose pituitaries were not making enough growth hormone on their own. Before the study, these children were growing about 4 cm per year. After 6 months of nightly Sermorelin, they were growing about 8 cm per year — close to doubling their growth rate. Importantly, their bones did not "age" faster than they grew taller, which matters because some growth interventions can cause the skeleton to mature too quickly. Blood sugar and other lab values stayed normal, and the injections were generally well tolerated.

Storage & handling

Lyophilized (unreconstituted): Store at -20°C, protected from light. Stable for 24+ months under correct storage. Avoid repeated temperature cycling.

Reconstituted: Dissolve in bacteriostatic water (typically 1–2 mL per 10 mg vial, depending on the research protocol). Store reconstituted solution at 2–8°C and use within 28 days. Do not freeze reconstituted solution. Sermorelin is sensitive to repeated warming — minimize the time the vial spends above refrigeration temperature.

Vial format: 10 mg lyophilized, vacuum-sealed glass vial with rubber stopper and aluminum crimp. Sterility tested per USP guidelines.

Shipping: Lyophilized Sermorelin is stable at ambient temperature for the typical 1–3 day shipping window. Cold-pack shipping available on request for researchers whose protocol requires it.

Frequently asked questions

What peptide sequence is Sermorelin?+

Sermorelin is the C-terminally amidated 29-amino-acid sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 (YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2), with a molecular weight of approximately 3357.9 g/mol. It corresponds to the first 29 residues of human growth hormone-releasing hormone and is the shortest fragment of GHRH that retains full receptor activity.

How is Sermorelin different from CJC-1295 (no DAC) and Tesamorelin?+

All three are GHRH-receptor agonists based on the GHRH(1-29) scaffold, but they differ in stability and structural modifications. Sermorelin is the unmodified native GHRH(1-29) fragment with a very short plasma half-life (~11–12 minutes in human studies). CJC-1295 no DAC (also known as Modified GRF 1-29) adds four amino acid substitutions to resist DPP-IV degradation, yielding modestly extended in vivo stability. Tesamorelin is a GHRH(1-44) analog with an N-terminal trans-3-hexenoic acid modification that markedly slows enzymatic degradation; it is the analog studied in adult endocrine research for visceral-adipose endpoints.

What does NovaWell test Sermorelin for?+

Every batch of Sermorelin supplied by NovaWell is tested by an independent third-party laboratory for: identity and purity (HPLC + MS), bacterial endotoxin (USP <85>), heavy metals (USP), and sterility (USP). Because Sermorelin contains a methionine residue, batches are also evaluated for the presence of methionine-sulfoxide oxidation products by mass spectrometry. The Certificate of Analysis for the currently shipping batch is linked from the Certificates tab on this page.

What is the purity of your current Sermorelin batch?+

Our current shipping batch is documented in the Certificates tab on this page, along with the test date, manufacturer ID, and the independent laboratory that performed the analysis. Recent batches have tested above 99% pure by HPLC, with methionine-sulfoxide content below the reporting threshold.

How should Sermorelin be stored after reconstitution?+

Once reconstituted in bacteriostatic water, Sermorelin should be stored at 2–8°C and used within 28 days. Do not freeze reconstituted solution. The lyophilized powder is stable at -20°C for 24+ months. Sermorelin is more sensitive to freeze-thaw cycles and prolonged warm-storage than some shorter peptides, so researchers should minimize the time the reconstituted vial spends outside refrigeration.

Where does NovaWell source Sermorelin?+

NovaWell sources Sermorelin from a vetted synthesis partner under our supplier qualification protocol, which includes facility audits and review of internal QC documentation. Every batch is then independently verified by a third-party laboratory before release. The manufacturer ID for the currently shipping batch is listed in the Description tab.